FGF7 (Human) Recombinant Protein
  • FGF7 (Human) Recombinant Protein

FGF7 (Human) Recombinant Protein

Ref: AB-P6223
FGF7 (Human) Recombinant Protein

Información del producto

Human FGF7 (P21781) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name FGF7
Gene Alias HBGF-7|KGF
Gene Description fibroblast growth factor 7 (keratinocyte growth factor)
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
If a precipitate is observed, centrifuge the so
Application Key WB,Func
Immunogen Prot. Seq MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 100 mM sodium chloride, pH 7.5.
Gene ID 2252

Enviar uma mensagem


FGF7 (Human) Recombinant Protein

FGF7 (Human) Recombinant Protein