IL8 (Human) Recombinant Protein View larger

Human IL8 (P10145) recombinant protein expressed in <i>E.Coli</i>.

AB-P6216

New product

IL8 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 ug
Gene Name IL8
Gene Alias CXCL8|GCP-1|GCP1|LECT|LUCT|LYNAP|MDNCF|MONAP|NAF|NAP-1|NAP1
Gene Description interleukin 8
Storage Conditions Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
Gene ID 3576

More info

Human IL8 (P10145) recombinant protein expressed in E.Coli.

Enviar uma mensagem

Human IL8 (P10145) recombinant protein expressed in <i>E.Coli</i>.

Human IL8 (P10145) recombinant protein expressed in <i>E.Coli</i>.