Oit1 (Mouse) Recombinant protein
  • Oit1 (Mouse) Recombinant protein

Oit1 (Mouse) Recombinant protein

Ref: AB-P5908
Oit1 (Mouse) Recombinant protein

Información del producto

Mouse Oit1 (NP_666162, 26 a.a. - 223 a.a.) partial recombinant protein with C-terminal hexahistidine tag expressed in HEK293EBNA1 cells.
Información adicional
Size 100 ug
Gene Name Oit1
Gene Alias 2310076N21Rik|AV067083|EF-7|Fam3d|MGC37550
Gene Description oncoprotein induced transcript 1
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 2.3 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq GSYTSFSRKTIRLPRWLGITPKDIQTPKSKCGLSKICPNNAFKISSGAANVVGPSMCFEDEIIMSPVRNNVGRGLNVALVNGSTGQVMKKDSFDMYSGDPQLLLNTEIPDSTLVLVASYDDPGTKMNDKIKTLFSNLGSSYAKQLGFRDSWVFVGAKDLKSKSPYEQKNNPETNKYDGWPELLELEGCVPRKVMAAAHHHHHH
Form Liquid
Antigen species Target species Mouse
Quality control testing NuPAGE Stained with Coomassie Blue
Storage Buffer In PBS without preservative
Gene ID 18300

Enviar uma mensagem


Oit1 (Mouse) Recombinant protein

Oit1 (Mouse) Recombinant protein