FAM3D (Human) Recombinant Protein
  • FAM3D (Human) Recombinant Protein

FAM3D (Human) Recombinant Protein

Ref: AB-P5907
FAM3D (Human) Recombinant Protein

Información del producto

Human FAM3D (NP_620160, 26 a.a. - 224 a.a.) partial recombinant protein with C-terminal hexahistidine tag expressed in HEK293EBNA1 cells.
Información adicional
Size 100 ug
Gene Name FAM3D
Gene Alias EF7|OIT1
Gene Description family with sequence similarity 3, member D
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq GSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVGAKDLRGKSPFEQKNSPDTNKYEGWPELLEMEGCMPPKPFAAAHHHHHH
Form Liquid
Antigen species Target species Human
Quality control testing NuPAGE Stained with Coomassie Blue
Storage Buffer In 25 mM Tris, 150 mM NaCl, pH 7.5 without preservative.
Gene ID 131177

Enviar uma mensagem


FAM3D (Human) Recombinant Protein

FAM3D (Human) Recombinant Protein