MBL2 (Human) Recombinant Protein
  • MBL2 (Human) Recombinant Protein

MBL2 (Human) Recombinant Protein

Ref: AB-P5889
MBL2 (Human) Recombinant Protein

Información del producto

Human MBL2 (NP_000233, 21a.a. - 248 a.a.) partial recombinant protein with N-terminal hexahistidine tag and a TEV cleavage site expressed in HEK293EBNA1 cells.
Información adicional
Size 100 ug
Gene Name MBL2
Gene Alias COLEC1|HSMBPC|MBL|MBP|MBP1|MGC116832|MGC116833
Gene Description mannose-binding lectin (protein C) 2, soluble (opsonic defect)
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 175 ug/mL
Application Key SDS-PAGE
Immunogen Prot. Seq GSHHHHHHDYDIPSSENLYFQGSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPIAAA
Form Liquid
Antigen species Target species Human
Quality control testing NuPAGE Stained with Coomassie Blue
Storage Buffer In PBS without preservative
Gene ID 4153

Enviar uma mensagem


MBL2 (Human) Recombinant Protein

MBL2 (Human) Recombinant Protein