SRA1 (Human) Recombinant Protein
  • SRA1 (Human) Recombinant Protein

SRA1 (Human) Recombinant Protein

Ref: AB-P5876
SRA1 (Human) Recombinant Protein

Información del producto

Human SRA1 (NP_001030312, 90 a.a. - 236 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name SRA1
Gene Alias MGC87674|SRA|SRAP|STRAA1|pp7684
Gene Description steroid receptor RNA activator 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (10% glycerol, 1 mM DTT).
Gene ID 10011

Enviar uma mensagem


SRA1 (Human) Recombinant Protein

SRA1 (Human) Recombinant Protein