MFAP2 (Human) Recombinant Protein
  • MFAP2 (Human) Recombinant Protein

MFAP2 (Human) Recombinant Protein

Ref: AB-P5874
MFAP2 (Human) Recombinant Protein

Información del producto

Human MFAP2 (NP_002394, 18 a.a. - 183 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name MFAP2
Gene Alias MAGP|MAGP-1|MAGP1
Gene Description microfibrillar-associated protein 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (1 M Urea, 20% glycerol).
Gene ID 4237

Enviar uma mensagem


MFAP2 (Human) Recombinant Protein

MFAP2 (Human) Recombinant Protein