FTSJ2 (Human) Recombinant Protein
  • FTSJ2 (Human) Recombinant Protein

FTSJ2 (Human) Recombinant Protein

Ref: AB-P5866
FTSJ2 (Human) Recombinant Protein

Información del producto

Human FTSJ2 (NP_037525, 51 a.a. - 246 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name FTSJ2
Gene Alias DKFZp686J14194|FJH1
Gene Description FtsJ homolog 2 (E. coli)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSSYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 0.15 M NaCl, pH 8.0 (30% glycerol, 1 mM DTT).
Gene ID 29960

Enviar uma mensagem


FTSJ2 (Human) Recombinant Protein

FTSJ2 (Human) Recombinant Protein