NEU1 (Human) Recombinant Protein
  • NEU1 (Human) Recombinant Protein

NEU1 (Human) Recombinant Protein

Ref: AB-P5860
NEU1 (Human) Recombinant Protein

Información del producto

Human NEU1 (NP_000425, 48 a.a. - 415 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name NEU1
Gene Alias FLJ93471|NANH|NEU|SIAL1
Gene Description sialidase 1 (lysosomal sialidase)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq GSSHHHHHHSSGLVPRGSHMGSHMENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVIN
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 0.15 M NaCl, pH 8.0 (10% glycerol, 1 mM DTT).
Gene ID 4758

Enviar uma mensagem


NEU1 (Human) Recombinant Protein

NEU1 (Human) Recombinant Protein