C22orf41 (Human) Recombinant Protein
  • C22orf41 (Human) Recombinant Protein

C22orf41 (Human) Recombinant Protein

Ref: AB-P5857
C22orf41 (Human) Recombinant Protein

Información del producto

Human C22orf41 (NP_001116697, 1 a.a. - 88 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name C22orf41
Gene Alias -
Gene Description chromosome 22 open reading frame 41
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRL
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 0.2 M NaCl, pH 8.0 (20% glycerol, 2 mM DTT).
Gene ID 644186

Enviar uma mensagem


C22orf41 (Human) Recombinant Protein

C22orf41 (Human) Recombinant Protein