EFNB3 (Human) Recombinant Protein
  • EFNB3 (Human) Recombinant Protein

EFNB3 (Human) Recombinant Protein

Ref: AB-P5856
EFNB3 (Human) Recombinant Protein

Información del producto

Human EFNB3 (NP_001397, 28 a.a. - 226 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name EFNB3
Gene Alias EFL6|EPLG8|LERK8
Gene Description ephrin-B3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSMP
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (20% glycerol, 2 M urea).
Gene ID 1949

Enviar uma mensagem


EFNB3 (Human) Recombinant Protein

EFNB3 (Human) Recombinant Protein