TK2 (Human) Recombinant Protein
  • TK2 (Human) Recombinant Protein

TK2 (Human) Recombinant Protein

Ref: AB-P5855
TK2 (Human) Recombinant Protein

Información del producto

Human TK2 (NP_004605, 34 a.a. - 265 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name TK2
Gene Alias -
Gene Description thymidine kinase 2, mitochondrial
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMVQRRAWPPDKEQEKEKKSVICVEGNIASGKTTCLEFFSNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDRILTPENRKH
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 200 mM NaCl, pH 8.0 (30% glycerol, 2 mM DTT).
Gene ID 7084

Enviar uma mensagem


TK2 (Human) Recombinant Protein

TK2 (Human) Recombinant Protein