LDOC1L (Human) Recombinant Protein
  • LDOC1L (Human) Recombinant Protein

LDOC1L (Human) Recombinant Protein

Ref: AB-P5852
LDOC1L (Human) Recombinant Protein

Información del producto

Human LDOC1L (NP_115663, 1 a.a. - 239 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name LDOC1L
Gene Alias DKFZp761O17121|Mar6|Mart6|dJ1033E15.2
Gene Description leucine zipper, down-regulated in cancer 1-like
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMVQPQTSKAESPALAASPNAQMDDVIDTLTSLRLTNSALRREASTLRAEKANLTNMLESVMAELTLLRTRARIPGALQITPPISSITSNGTRPMTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQASRFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLRNNYQGFLAELRRTYKSPLRHARRAQIRKTSASNRAVRERQMLCRQLASAGTGPCPVHPASNGTSPAPA
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, 1 mM EDTA, pH 8.0 (40% glycerol, 2 mM DTT, 0.1 mM PMSF).
Gene ID 84247

Enviar uma mensagem


LDOC1L (Human) Recombinant Protein

LDOC1L (Human) Recombinant Protein