CRYGN (Human) Recombinant Protein
  • CRYGN (Human) Recombinant Protein

CRYGN (Human) Recombinant Protein

Ref: AB-P5851
CRYGN (Human) Recombinant Protein

Información del producto

Human CRYGN (NP_653328, 1 a.a. - 182 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name CRYGN
Gene Alias MGC119042|MGC119043|MGC119044|MGC119045
Gene Description crystallin, gamma N
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMAQRSGKITLYEGKHFTGQKLEVFGDCDNFQDRGFMNRVNSIHVESGAWVCFNHPDFRGQQFILEHGDYPDFFRWNSHSDHMGSCRPVGMHGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWVKNCVNTIKVYGDGAAWSPRSFGAEDFQLSSSLQSDQGPEEATTKPATTQPPFLTANL
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (0.4 M Urea, 10% glycerol).
Gene ID 155051

Enviar uma mensagem


CRYGN (Human) Recombinant Protein

CRYGN (Human) Recombinant Protein