Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
VTA1 (Human) Recombinant Protein
Abnova
VTA1 (Human) Recombinant Protein
Ref: AB-P5849
VTA1 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human VTA1 (NP_057569, 1 a.a. - 307 a.a. ) full-length recombinant protein with His tag expressed in
Escherichia coli
.
Información adicional
Size
100 ug
Gene Name
VTA1
Gene Alias
C6orf55|DRG-1|DRG1|FLJ27228|HSPC228|LIP5|My012|SBP1
Gene Description
Vps20-associated 1 homolog (S. cerevisiae)
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMGSHMAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAEVPHS
Form
Liquid
Antigen species Target species
Human
Quality control testing
3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer
In 20 mM Tris-HCl buffer, 200 mM NaCl, pH 8.0 (2 mM DTT, 10% glycerol).
Gene ID
51534
Enviar uma mensagem
VTA1 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*