TXNDC12 (Human) Recombinant Protein
  • TXNDC12 (Human) Recombinant Protein

TXNDC12 (Human) Recombinant Protein

Ref: AB-P5844
TXNDC12 (Human) Recombinant Protein

Información del producto

Human TXNDC12 (NP_056997, 27 a.a. - 172 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name TXNDC12
Gene Alias AGR1|ERP18|ERP19|TLP19|hAG-1
Gene Description thioredoxin domain containing 12 (endoplasmic reticulum)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 0.15 M NaCl, pH 8.0 (10% glycerol).
Gene ID 51060

Enviar uma mensagem


TXNDC12 (Human) Recombinant Protein

TXNDC12 (Human) Recombinant Protein