EIF4H (Human) Recombinant Protein
  • EIF4H (Human) Recombinant Protein

EIF4H (Human) Recombinant Protein

Ref: AB-P5402
EIF4H (Human) Recombinant Protein

Información del producto

Human EIF4H (NP_001098751, 1 a.a. - 140 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name EIF4H
Gene Alias KIAA0038|WBSCR1|WSCR1
Gene Description eukaryotic translation initiation factor 4H
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNSGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSA
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.2 M NaCl, pH 8.0 (50% glycerol, 2 mM DTT).
Gene ID 7458

Enviar uma mensagem


EIF4H (Human) Recombinant Protein

EIF4H (Human) Recombinant Protein