AS3MT (Human) Recombinant Protein View larger

Human AS3MT (NP_065733, 1 a.a. - 375 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P5400

New product

AS3MT (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name AS3MT
Gene Alias CYT19
Gene Description arsenic (+3 oxidation state) methyltransferase
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHMEKYGFQASNVTFIHGYIEKLGEAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGALYWKELAVLAQKIGFCPPRLV
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.15 M NaCl, pH 8.0 (10% glycerol).
Gene ID 57412

More info

Human AS3MT (NP_065733, 1 a.a. - 375 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human AS3MT (NP_065733, 1 a.a. - 375 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human AS3MT (NP_065733, 1 a.a. - 375 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.