TATDN3 (Human) Recombinant Protein
  • TATDN3 (Human) Recombinant Protein

TATDN3 (Human) Recombinant Protein

Ref: AB-P5396
TATDN3 (Human) Recombinant Protein

Información del producto

Human TATDN3 (NP_001036017, 1 a.a. - 274 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name TATDN3
Gene Alias MGC142198
Gene Description TatD DNase domain containing 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMRAAGVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCLGVHPVQGLPPEDQRSVTLKDLDVALPIIENYKDRLLAIGEVGLDFSPRFAGTGEQKEEQRQVLIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGAEKVLLHAFDGRPSVAMEGVRAGYFFSIPPSIIRSGQKQKLVKQLPLTSICLETDSPALGPEKQVRNE
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.2 M NaCl, pH 8.0 (20% glycerol, 1 mM DTT).
Gene ID 128387

Enviar uma mensagem


TATDN3 (Human) Recombinant Protein

TATDN3 (Human) Recombinant Protein