CRYGC (Human) Recombinant Protein
  • CRYGC (Human) Recombinant Protein

CRYGC (Human) Recombinant Protein

Ref: AB-P5395
CRYGC (Human) Recombinant Protein

Información del producto

Human CRYGC (NP_066269, 1 a.a. - 174 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name CRYGC
Gene Alias CCL|CRYG3
Gene Description crystallin, gamma C
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 200 mM NaCl, pH 8.0 (10% glycerol, 2 mM DTT).
Gene ID 1420

Enviar uma mensagem


CRYGC (Human) Recombinant Protein

CRYGC (Human) Recombinant Protein