TXNDC17 (Human) Recombinant Protein
  • TXNDC17 (Human) Recombinant Protein

TXNDC17 (Human) Recombinant Protein

Ref: AB-P5388
TXNDC17 (Human) Recombinant Protein

Información del producto

Human TXNDC17 (NP_116120, 1 a.a. - 123 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name TXNDC17
Gene Alias MGC14353|TRP14|TXNL5
Gene Description thioredoxin domain containing 17
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.05 M NaCl, pH 8.0 (10% glycerol).
Gene ID 84817

Enviar uma mensagem


TXNDC17 (Human) Recombinant Protein

TXNDC17 (Human) Recombinant Protein