PAK6 (Human) Recombinant Protein View larger

Human PAK6 kinase domain (Q9NQU5, 385 a.a. - 680 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P5386

New product

PAK6 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 7 pontos de fidelização. Seu carrinho totalizará 7 pontos de fidelização que podem ser convertidos num vale de desconto de 28.00EUR.


Data sheet

Size 10 ug
Gene Name PAK6
Gene Alias PAK5
Gene Description p21 protein (Cdc42/Rac)-activated kinase 6
Storage Conditions Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/ml
Application Key Func,SDS-PAGE
Immunogen Prot. Seq <u><b>GPHM</b></u>VTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGIVCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEELWVLMEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRVKLSDFGFCAQISKDVPKRK<u><b>S</u></b>LVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPPYFSDSPV
Form Liquid
Antigen species Target species Human
Quality control testing Loading 7 ug protein in SDS-PAGE
Storage Buffer In 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Gene ID 56924

More info

Human PAK6 kinase domain (Q9NQU5, 385 a.a. - 680 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human PAK6 kinase domain (Q9NQU5, 385 a.a. - 680 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Human PAK6 kinase domain (Q9NQU5, 385 a.a. - 680 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.