PAK2 (Human) Recombinant Protein
  • PAK2 (Human) Recombinant Protein

PAK2 (Human) Recombinant Protein

Ref: AB-P5383
PAK2 (Human) Recombinant Protein

Información del producto

Human PAK2 kinase domain (Q13177, 227 a.a. - 524 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name PAK2
Gene Alias PAK65|PAKgamma
Gene Description p21 protein (Cdc42/Rac)-activated kinase 2
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/ml
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPHMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR
Form Liquid
Antigen species Target species Human
Quality control testing Loading 6 ug protein in SDS-PAGE
Storage Buffer In 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Gene ID 5062

Enviar uma mensagem


PAK2 (Human) Recombinant Protein

PAK2 (Human) Recombinant Protein