Il10 (Rat) Recombinant Protein
  • Il10 (Rat) Recombinant Protein

Il10 (Rat) Recombinant Protein

Ref: AB-P5038
Il10 (Rat) Recombinant Protein

Información del producto

Rat Il10 (P29456, 19 a.a. - 178 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Il10
Gene Alias IL10X
Gene Description interleukin 10
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS, pH 7.5
Gene ID 25325

Enviar uma mensagem


Il10 (Rat) Recombinant Protein

Il10 (Rat) Recombinant Protein