Fgf2 (Rat) Recombinant Protein
  • Fgf2 (Rat) Recombinant Protein

Fgf2 (Rat) Recombinant Protein

Ref: AB-P5037
Fgf2 (Rat) Recombinant Protein

Información del producto

Rat Fgf2 (P13109, 10 a.a. - 154 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name Fgf2
Gene Alias Fgf-2|bFGF
Gene Description fibroblast growth factor 2
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq PALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS, pH 7.5
Gene ID 54250

Enviar uma mensagem


Fgf2 (Rat) Recombinant Protein

Fgf2 (Rat) Recombinant Protein