CSN2 (Human) Recombinant Protein
  • CSN2 (Human) Recombinant Protein

CSN2 (Human) Recombinant Protein

Ref: AB-P5011
CSN2 (Human) Recombinant Protein

Información del producto

Human CSN2 (NP_001882, 16 a.a. - 226 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name CSN2
Gene Alias CASB
Gene Description casein beta
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.25 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMRETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 (20% glycerol, 1 mM DTT, 0.1 mM PMSF).
Gene ID 1447

Enviar uma mensagem


CSN2 (Human) Recombinant Protein

CSN2 (Human) Recombinant Protein