sodA (<i>Escherichia coli</i>) Recombinant Protein View larger

<i>Escherichia coli</i> sodA (NP_418344, 1 a.a. - 206 a.a.) full-length recombinant protein with His tag expressed in <i>Escheri

AB-P5002

New product

sodA (Escherichia coli) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name sodA
Gene Alias ECK3901|JW3879
Gene Description superoxide dismutase, Mn
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Form Liquid
Antigen species Target species Escherichia coli
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID 948403

More info

Escherichia coli sodA (NP_418344, 1 a.a. - 206 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

<i>Escherichia coli</i> sodA (NP_418344, 1 a.a. - 206 a.a.) full-length recombinant protein with His tag expressed in <i>Escheri

<i>Escherichia coli</i> sodA (NP_418344, 1 a.a. - 206 a.a.) full-length recombinant protein with His tag expressed in <i>Escheri