View larger
<i>Escherichia coli</i> msrA (NP_418640, 1 a.a. - 212 a.a.) full-length recombinant protein with His tag expressed in <i>Escheri
AB-P5001
New product
msrA (Escherichia coli) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | msrA |
| Gene Alias | ECK4215|JW4178|pms|pmsR |
| Gene Description | methionine sulfoxide reductase A |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMSLFDKKHLVSPADALPGRNTPMPVATLHAVNGHSMTNVPDGMEIAIFAMGCFWGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAADDDRHITTEIANATPFYYAEDDHQQYLHKNPYGYCGIGGIGVCLPPEA |
| Form | Liquid |
| Antigen species Target species | Escherichia coli |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol). |
| Gene ID | 948734 |
More info
Escherichia coli msrA (NP_418640, 1 a.a. - 212 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.