Streptavidin (<i>Streptomyces avidinii</i>) Recombinant Protein
  • Streptavidin (<i>Streptomyces avidinii</i>) Recombinant Protein

Streptavidin (<i>Streptomyces avidinii</i>) Recombinant Protein

Ref: AB-P4990
Streptavidin (Streptomyces avidinii) Recombinant Protein

Información del producto

Streptomyces avidinii Streptavidin (CAA27265, P22629, 25 a.a. - 183 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MVHHHHHHDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Form Liquid
Antigen species Target species Bacteria
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris, pH 7.5.

Enviar uma mensagem


Streptavidin (<i>Streptomyces avidinii</i>) Recombinant Protein

Streptavidin (<i>Streptomyces avidinii</i>) Recombinant Protein