View larger
<i>Streptomyces avidinii</i> Streptavidin (CAA27265, P22629, 25 a.a. - 183 a.a.) partial recombinant protein with His tag expres
AB-P4990
New product
Streptavidin (Streptomyces avidinii) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MVHHHHHHDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Form | Liquid |
| Antigen species Target species | Bacteria |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris, pH 7.5. |
More info
Streptomyces avidinii Streptavidin (CAA27265, P22629, 25 a.a. - 183 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.