udp (<i>Escherichia coli</i>) Recombinant protein
  • udp (<i>Escherichia coli</i>) Recombinant protein

udp (<i>Escherichia coli</i>) Recombinant protein

Ref: AB-P4984
udp (Escherichia coli) Recombinant protein

Información del producto

Escherichia coli udp (NP_418275, 1 a.a. - 253 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name udp
Gene Alias ECK3825|JW3808
Gene Description uridine phosphorylase
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMSKSDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMK
Form Liquid
Antigen species Target species Escherichia coli
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, 50 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID 948987

Enviar uma mensagem


udp (<i>Escherichia coli</i>) Recombinant protein

udp (<i>Escherichia coli</i>) Recombinant protein