View larger
<i>Escherichia coli</i> nfsB (NP_415110, 1 a.a. - 217 a.a.) full-length recombinant protein with His tag expressed in <i>Escheri
AB-P4983
New product
nfsB (Escherichia coli) Recombinant protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | nfsB |
| Gene Alias | ECK0570|JW0567|dprA|nfnB|nfsI|ntr |
| Gene Description | dihydropteridine reductase, NAD(P)H-dependent, oxygen-insensitive |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARVAKSAAGNYVFNERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKGRKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKEKGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV |
| Form | Liquid |
| Antigen species Target species | Escherichia coli |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 20 mM Tris-HCl buffer, 50 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol). |
| Gene ID | 945778 |
More info
Escherichia coli nfsB (NP_415110, 1 a.a. - 217 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.