AB-P4978
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 100 ug |
Gene Name | ccmG |
Gene Alias | ECK2187|JW2183|dsbE|yejQ |
Gene Description | periplasmic thioredoxin of cytochrome c-type biogenesis |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Concentration | 1 mg/mL |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | MRNAEGDDPTNLESALIGKPVPKFRLESLDNPGQFYQADVLTQGKPVLLNVWATWCPTCRAEHQYLNQLSAQGIRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDLNPRVWEEEIKPLWEKYSKEAAQ |
Form | Liquid |
Antigen species Target species | Escherichia coli |
Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
Storage Buffer | In 20 mM Tris-HCl buffer, 2 mM EDTA, pH 7.5 (10% glycerol). |
Gene ID | 949073 |