AB-P4962
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 100 ug |
Gene Name | dnaK |
Gene Alias | ECK0014|JW0013|groPAB|groPC|groPF|grpC|grpF|seg |
Gene Description | chaperone Hsp70, co-chaperone with DnaJ |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Concentration | 1 mg/mL |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | MDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHST |
Form | Liquid |
Antigen species Target species | Escherichia coli |
Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
Storage Buffer | In 25 mM Tris-HCl buffer, 1 mM EDTA, pH 7.5 (2 mM beta-mercaptoethanol). |
Gene ID | 944750 |