CD274 (Human) Recombinant Protein
  • CD274 (Human) Recombinant Protein

CD274 (Human) Recombinant Protein

Ref: AB-P4938
CD274 (Human) Recombinant Protein

Información del producto

Human CD274 Recombinant protein fused to murine IgG2a Fc and hinge region purifird from CHO cells.
Información adicional
Size 25 ug
Gene Name CD274
Gene Alias B7-H|B7H1|MGC142294|MGC142296|PD-L1|PDCD1L1|PDCD1LG1|PDL1
Gene Description CD274 molecule
Storage Conditions Store at 4C. This product is stable for at least 3 months.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq CD274 mature: ftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvqhssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapynkinqrilvvdpvtseheltcqaegypkaeviwtssdhqvlsgkttttnskreeklfnvtstlrintttneifyctfrrldpeenhtaelvipelplahppnerthtr
Linker +Murin
Form Liquid
Antigen species Target species Human
Storage Buffer In 50 mM sodium phosphate, 100 mM potassium chloride, 150 mM NaCl, pH 7.5. (0.5 mg/mL gentamicin sulfate)
Gene ID 29126

Enviar uma mensagem


CD274 (Human) Recombinant Protein

CD274 (Human) Recombinant Protein