CTLA4 (Human) Recombinant Protein
  • CTLA4 (Human) Recombinant Protein

CTLA4 (Human) Recombinant Protein

Ref: AB-P4933
CTLA4 (Human) Recombinant Protein

Información del producto

Human CTLA4 recombinant protein fused to murine IgG2a Fc purified from CHO cells.
Información adicional
Size 25 ug
Gene Name CTLA4
Gene Alias CD152|CELIAC3|CTLA-4|GSE|IDDM12
Gene Description cytotoxic T-lymphocyte-associated protein 4
Storage Conditions Store at 4C. This product is stable for at least 3 months.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq CTLA4 mature: mhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymtgneltflddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngtqiyvidpepcpdsdf
Fused to murine IgG2a Fc: eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstl
Form Liquid
Antigen species Target species Human
Storage Buffer In 50 mM sodium phosphate, 100 mM potassium chloride, 150 mM NaCl, pH 7.5. (0.5 mg/mL gentamicin sulfate)
Gene ID 1493

Enviar uma mensagem


CTLA4 (Human) Recombinant Protein

CTLA4 (Human) Recombinant Protein