View larger
Human CTLA4 recombinant protein fused to murine IgG2a Fc purified from CHO cells.
AB-P4933
New product
CTLA4 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 7 pontos de fidelização. Seu carrinho totalizará 7 pontos de fidelização que podem ser convertidos num vale de desconto de 28.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | CTLA4 |
| Gene Alias | CD152|CELIAC3|CTLA-4|GSE|IDDM12 |
| Gene Description | cytotoxic T-lymphocyte-associated protein 4 |
| Storage Conditions | Store at 4ºC. This product is stable for at least 3 months. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | CTLA4 mature: mhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymtgneltflddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngtqiyvidpepcpdsdf<br>Fused to murine IgG2a Fc: eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstl |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | In 50 mM sodium phosphate, 100 mM potassium chloride, 150 mM NaCl, pH 7.5. (0.5 mg/mL gentamicin sulfate) |
| Gene ID | 1493 |
More info
Human CTLA4 recombinant protein fused to murine IgG2a Fc purified from CHO cells.