NS3 (HCV) Recombinant Protein
  • NS3 (HCV) Recombinant Protein

NS3 (HCV) Recombinant Protein

Ref: AB-P4911
NS3 (HCV) Recombinant Protein

Información del producto

NS3 (HCV) (NP_671491, 1225 a.a. - 1456 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name HCVgp1
Gene Alias -
Gene Description polyprotein
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTG
Form Liquid
Antigen species Target species Viruses
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol, 1 mM DTT).
Gene ID 951475

Enviar uma mensagem


NS3 (HCV) Recombinant Protein

NS3 (HCV) Recombinant Protein