PPA1 (Human) Recombinant Protein
  • PPA1 (Human) Recombinant Protein

PPA1 (Human) Recombinant Protein

Ref: AB-P4908
PPA1 (Human) Recombinant Protein

Información del producto

Human PPA1 (NP_066952, 1 a.a. - 289 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PPA1
Gene Alias IOPPP|MGC111556|PP|PP1|SID6-8061
Gene Description pyrophosphatase (inorganic) 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALV
Form Liquid
Antigen species Target species Human
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, 200 mM NaCl, pH 8.0 (2 mM DTT, 20% glycerol).
Gene ID 5464

Enviar uma mensagem


PPA1 (Human) Recombinant Protein

PPA1 (Human) Recombinant Protein