HBsAg (preS1) Recombinant Protein
  • HBsAg (preS1) Recombinant Protein

HBsAg (preS1) Recombinant Protein

Ref: AB-P4876
HBsAg (preS1) Recombinant Protein

Información del producto

HBsAg preS1(AAK51534, 119 amino acids) Recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA
Form Liquid
Antigen species Target species Viruses
Storage Buffer In 20 mM PB, 50 mM NaCl, pH 7.4

Enviar uma mensagem


HBsAg (preS1) Recombinant Protein

HBsAg (preS1) Recombinant Protein