Vegfa (Rat) Recombinant Protein
  • Vegfa (Rat) Recombinant Protein

Vegfa (Rat) Recombinant Protein

Ref: AB-P4853
Vegfa (Rat) Recombinant Protein

Información del producto

Rat Vegfa recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Vegfa
Gene Alias VEGF164|Vegf
Gene Description vascular endothelial growth factor A
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from 10 mM NaP, pH 7.5
Gene ID 83785

Enviar uma mensagem


Vegfa (Rat) Recombinant Protein

Vegfa (Rat) Recombinant Protein