Ccl5 (Rat) Recombinant Protein
  • Ccl5 (Rat) Recombinant Protein

Ccl5 (Rat) Recombinant Protein

Ref: AB-P4850
Ccl5 (Rat) Recombinant Protein

Información del producto

Rat Ccl5 recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ccl5
Gene Alias Rantes|Scya5
Gene Description chemokine (C-C motif) ligand 5
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer No additive
Gene ID 81780

Enviar uma mensagem


Ccl5 (Rat) Recombinant Protein

Ccl5 (Rat) Recombinant Protein