Ccl2 (Rat) Recombinant Protein
  • Ccl2 (Rat) Recombinant Protein

Ccl2 (Rat) Recombinant Protein

Ref: AB-P4848
Ccl2 (Rat) Recombinant Protein

Información del producto

Rat Ccl2 recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Ccl2
Gene Alias MCP-1|Scya2|Sigje
Gene Description chemokine (C-C motif) ligand 2
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer No additive
Gene ID 24770

Enviar uma mensagem


Ccl2 (Rat) Recombinant Protein

Ccl2 (Rat) Recombinant Protein