Il17f (Rat) Recombinant Protein
  • Il17f (Rat) Recombinant Protein

Il17f (Rat) Recombinant Protein

Ref: AB-P4846
Il17f (Rat) Recombinant Protein

Información del producto

Rat Il17f recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name Il17f
Gene Alias MGC114402
Gene Description interleukin 17F
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer No additive
Gene ID 301291

Enviar uma mensagem


Il17f (Rat) Recombinant Protein

Il17f (Rat) Recombinant Protein