IL25 (Rat) Recombinant Protein
  • IL25 (Rat) Recombinant Protein

IL25 (Rat) Recombinant Protein

Ref: AB-P4845
IL25 (Rat) Recombinant Protein

Información del producto

Rat IL25 recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL25
Gene Alias IL-17E|IL-25|IL17E
Gene Description interleukin 25
Storage Conditions Store at -20ºC on dry atmosphere.
After reconstitution with sterilized 20 mM HCl, store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MCSHLPRCCPSKQQEFPEEWLKWNPAPVSPPEPLRHTHHPESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPMGNSVPLYHNQTVFYRRPCHGEQGAHGRYCLERRLYRVSLACVCVRPRMMA
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer No additive
Gene ID 64806

Enviar uma mensagem


IL25 (Rat) Recombinant Protein

IL25 (Rat) Recombinant Protein