Il17a/Il17f (Rat) Recombinant Protein View larger

Rat Il17a/Il17f (heterodimer) recombinant protein expressed in <i>Escherichia coli</i>.

AB-P4844

New product

Il17a/Il17f (Rat) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 25 ug
Gene Name Il17a
Gene Alias -
Gene Description interleukin 17A
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq Il17a: MAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS<br>Il17f: MARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLR
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer No additive
Gene ID 301289|301291

More info

Rat Il17a/Il17f (heterodimer) recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Rat Il17a/Il17f (heterodimer) recombinant protein expressed in <i>Escherichia coli</i>.

Rat Il17a/Il17f (heterodimer) recombinant protein expressed in <i>Escherichia coli</i>.