Il17a (Rat) Recombinant Protein
  • Il17a (Rat) Recombinant Protein

Il17a (Rat) Recombinant Protein

Ref: AB-P4843
Il17a (Rat) Recombinant Protein

Información del producto

Rat Il17a recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name Il17a
Gene Alias -
Gene Description interleukin 17A
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer Lyophilized from 10 mM sodium citrate, pH 3.0
Gene ID 301289

Enviar uma mensagem


Il17a (Rat) Recombinant Protein

Il17a (Rat) Recombinant Protein