Igf1 (Rat) Recombinant Protein
  • Igf1 (Rat) Recombinant Protein

Igf1 (Rat) Recombinant Protein

Ref: AB-P4840
Igf1 (Rat) Recombinant Protein

Información del producto

Rat Igf1 recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name Igf1
Gene Alias -
Gene Description insulin-like growth factor 1
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer No additive
Gene ID 24482

Enviar uma mensagem


Igf1 (Rat) Recombinant Protein

Igf1 (Rat) Recombinant Protein