Pdgfb/Pdgfb (Mouse) Recombinant Protein
  • Pdgfb/Pdgfb (Mouse) Recombinant Protein

Pdgfb/Pdgfb (Mouse) Recombinant Protein

Ref: AB-P4803
Pdgfb/Pdgfb (Mouse) Recombinant Protein

Información del producto

Mouse Pdgfb (homodimer) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Pdgfb
Gene Alias PDGF-B|Sis
Gene Description platelet derived growth factor, B polypeptide
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from 10 mM sodium citrate, pH 3.0
Gene ID 18591

Enviar uma mensagem


Pdgfb/Pdgfb (Mouse) Recombinant Protein

Pdgfb/Pdgfb (Mouse) Recombinant Protein