Fgf9 (Rat) Recombinant Protein
  • Fgf9 (Rat) Recombinant Protein

Fgf9 (Rat) Recombinant Protein

Ref: AB-P4801
Fgf9 (Rat) Recombinant Protein

Información del producto

Rat Fgf9 recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Fgf9
Gene Alias -
Gene Description fibroblast growth factor 9
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer Lyophilized from 10 mM NaP, 75 mM (NH 4 )2 SO4, pH 7.5
Gene ID 25444

Enviar uma mensagem


Fgf9 (Rat) Recombinant Protein

Fgf9 (Rat) Recombinant Protein