AB-P4801
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 10 ug |
Gene Name | Fgf9 |
Gene Alias | - |
Gene Description | fibroblast growth factor 9 |
Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | MPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Form | Lyophilized |
Antigen species Target species | Rat |
Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue |
Storage Buffer | Lyophilized from 10 mM NaP, 75 mM (NH<sub> 4</sub> )<sub>2</sub> SO<sub>4</sub>, pH 7.5 |
Gene ID | 25444 |