IL17A/IL17F (Human) Recombinant Protein View larger

Human IL17A/IL17F (heterodimer) recombinant protein expressed in <i>Escherichia coli</i>.

AB-P4799

New product

IL17A/IL17F (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 25 ug
Gene Name IL17A
Gene Alias CTLA8|IL-17|IL-17A|IL17
Gene Description interleukin 17A
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq IL-17A: MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA<br>IL-17F: MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQET
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer No additive
Gene ID 3605|112744

More info

Human IL17A/IL17F (heterodimer) recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human IL17A/IL17F (heterodimer) recombinant protein expressed in <i>Escherichia coli</i>.

Human IL17A/IL17F (heterodimer) recombinant protein expressed in <i>Escherichia coli</i>.