STK16 (Human) Recombinant Protein
  • STK16 (Human) Recombinant Protein

STK16 (Human) Recombinant Protein

Ref: AB-P4788
STK16 (Human) Recombinant Protein

Información del producto

Human STK16 (NP_001008910.1, 1 a.a. - 305 a.a.) full-length recombinant protein with GST-His tag with a Thrombin cleavage site at N-terminal expressed in Sf9 insect cells.
Información adicional
Size 100 ug
Gene Name STK16
Gene Alias FLJ39635|KRCT|MPSK|PKL12|TSF1
Gene Description serine/threonine kinase 16
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing
Concentration 1.020 ug/uL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDPMGHHHHHHGRRRASVAAGILVPRGSPGLDGIYAR
Form Liquid
Antigen species Target species Human
Quality control testing 2 ug/lane SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 50 mM Tris-HCl, 100 mM NaCl, pH 8.0 (5 mM DTT, 15 mM reduced glutathione, 20% glycerol).
Gene ID 8576

Enviar uma mensagem


STK16 (Human) Recombinant Protein

STK16 (Human) Recombinant Protein